5-HT1B Antibody

Immunohistochemistry-Paraffin: 5-HT1B Antibody [NBP2-55461] - Staining in human placenta and skeletal muscle tissues using anti-HTR1B antibody. Corresponding HTR1B RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: 5-HT1B Antibody [NBP2-55461] - Staining of human cell line A549 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: 5-HT1B Antibody [NBP2-55461] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: 5-HT1B Antibody [NBP2-55461] - Staining of human skeletal muscle shows low expression as expected.

Product Discontinued

5-HT1B Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR1B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for 5-HT1B Antibody

• 5HT1B
• 5-HT1B
• 5-HT1B5-HT-1B
• 5HT1DB
• 5-HT1DB
• 5-hydroxytryptamine (serotonin) receptor 1B
• HTR1B
• HTR1D2
• HTR1D2,5-hydroxytryptamine receptor 1B
• HTR1DB
• S12
• S125-HT-1D-beta
• Serotonin 1D beta receptor
• Serotonin receptor 1B

Background

5HT1B Receptor is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HTR1B