6 Phosphofructo 2 Kinase Antibody (3F3) - Azide and BSA Free

Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 expression in transfected 293T cell line by PFKFB3 monoclonal antibody (M08), clone 3F3. Lane 1: PFKFB3 transfected lysatE (59.6 KDa). Lane 2: Non-transfected lysate.

Western Blot: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Analysis of PFKFB3 transfected lysate using anti-PFKFB3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PFKFB3 rabbit polyclonal antibody.

ELISA: 6 Phosphofructo 2 Kinase Antibody (3F3) [H00005209-M08] - Detection limit for recombinant GST tagged PFKFB3 is approximately 3ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clone: 3F3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

6 Phosphofructo 2 Kinase Antibody (3F3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PFKFB3 (NP_004557, 412 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
• Specificity: PFKFB3 - 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 (3F3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PFKFB3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 22421967). Mouse reactivity reported in scientific literature (PMID: 24169697).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 6 Phosphofructo 2 Kinase Antibody (3F3) - Azide and BSA Free

• 6 Phosphofructo 2 Kinase
• 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase
• 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
• 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
• FLJ37326
• inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
• IPFK2
• PFK/FBPase 3
• PFK2
• PFKFB3
• Renal carcinoma antigen NY-REN-56

Background

Synthesis and degradation of fructose 2,6-bisphosphate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08)(16)

Publications using H00005209-M08

• Emmanuel C, Benjamin B, Pierre M et al. Differential role of neuronal glucose and PFKFB3 in memory formation during development. Glia. 2022-08-02 [PMID: 35916383]
• Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014-01-01 [PMID: 25461272]
• Desideri E, Vegliante R, Cardaci S et al. MAPK14/p38alpha-dependent modulation of glucose metabolism affects ROS levels and autophagy during starvation. Autophagy 2014-09-01 [PMID: 25046111] (WB)
• Bao Y, Mukai K, Hishiki T et al. Energy management by enhanced glycolysis in G1-phase in human colon cancer cells in vitro and in vivo. Mol Cancer Res. 2013-09-01 [PMID: 23741060] (WB, Human)
• Huang Y, Bell LN, Okamura J et al. Phospho-deltaNp63alpha/SREBF1 protein interactions: Bridging cell metabolism and cisplatin chemoresistance Cell Cycle 2012-09-05 [PMID: 22951905] (WB, Human)
• Rodriguez-Rodriguez P, Fernandez E et al. Excitotoxic stimulus stabilizes PFKFB3 causing pentose-phosphate pathway to glycolysis switch and neurodegeneration Cell Death Differ 2012-03-16 [PMID: 22421967] (WB, Rat)
• Almeida A, Bolanos JP, Moncada Set. E3 ubiquitin ligase APC/C-Cdh1 accounts for the Warburg effect by linking glycolysis to cell proliferation. Proc Natl Acad Sci U S A 2010-01-12 [PMID: 20080744] (WB, Human)
• Jimenez-Blasco D, Agulla J, Lapresa R et al. Weak neuronal glycolysis sustains cognition and organismal fitness bioRxiv 2023-09-04 (WB, IHC, Mouse)
• Daniel Jimenez-Blasco, Jesús Agulla, Rebeca Lapresa, Marina Garcia-Macia, Veronica Bobo-Jimenez, Dario Garcia-Rodriguez, Israel Manjarres-Raza, Emilio Fernandez, Yannick Jeanson, Spiro Khoury, Jean-Charles Portais, Daniel Padro, Pedro Ramos-Cabrer, Peter Carmeliet, Angeles Almeida, Juan P Bolaños Weak neuronal glycolysis sustains cognition and organismal fitness. Nature metabolism 2024-05-24 [PMID: 38789798]
• Lopez-Fabuel I, Garcia-Macia M, Buondelmonte C et al. Aberrant upregulation of the glycolytic enzyme PFKFB3 in CLN7 neuronal ceroid lipofuscinosis Nature communications 2022-01-27 [PMID: 35087090] (WB, Mouse)
• Burmistrova O, Olias-Arjona A, Lapresa R et al. Targeting PFKFB3 alleviates cerebral ischemia-reperfusion injury in mice Sci Rep 2019-08-12 [PMID: 31406177] (WB, Mouse)
• RodrIguez C, SAnchez-MorAn I, Alvarez S et al. A novel human Cdh1 mutation impairs anaphase promoting complex/cyclosome (APC/C) activity resulting in microcephaly, psychomotor retardation and epilepsy J. Neurochem. 2019-07-18 [PMID: 31318984] (WB, Human)
• Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014-03-17 [PMID: 24633012] (WB, Human)
• Cordero-Espinoza L, Hagen T. Increased concentrations of Fructose-2,6-bisphosphate contribute to the Warburg effect in PTEN-deficient cells. J Biol Chem. 2013-10-29 [PMID: 24169697] (WB, Mouse)
• Amako Y, Sarkeshik A, Hotta H et al. Role of Oxysterol Binding Protein in Hepatitis C Virus infection. J Virol :JVI00958-00909. 2009-01-01 [PMID: 19570870]
• Yalcin A, Clem BF, Simmons A et al. Nuclear Targeting of 6-Phosphofructo-2-kinase (PFKFB3) Increases Proliferation via Cyclin-dependent Kinases. J Biol Chem;284(36):24223-24232. 2009-01-01 [PMID: 19473963]

Review for 6 Phosphofructo 2 Kinase Antibody (H00005209-M08) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Amy Clem WB Human 12/08/2010

Summary

• Application: Western Blot
• Sample Tested: A549 Nuclear and cytoplasmic, Sample Amount: 30ug
• Species: Human
• Lot: 10194-3F3

Bioinformatics

• Gene Symbol: PFKFB3
• Entrez:
  • 5209(Human)
• Uniprot:
  • NP_004557(Human)