ABCB6 Antibody

Western Blot: ABCB6 Antibody [NBP2-58327] - Analysis in human cell lines Caco-2 and A-431. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.

Immunocytochemistry/Immunofluorescence: ABCB6 Antibody [NBP2-58327] - Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

Product Discontinued

ABCB6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29879439).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABCB6 Antibody

• ABC
• ABC14
• ABCB6
• ATP-binding cassette, sub-family B (MDR/TAP), member 6
• EC 3.6.3
• EST45597
• FLJ22414
• LAN
• MCOPCB7
• Mitochondrial ABC transporter 3
• mitochondrial
• MTABC3
• MTABC3ABC14
• P-glycoprotein-related protein
• PRP
• Umat

Background

"The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ABCB6 Antibody (NBP2-58327)(1)

Publication using NBP2-58327

• Kaisar MA, Sivandzade F, Bhalerao A, Cucullo L Conventional and electronic cigarettes dysregulate the expression of iron transporters and detoxifying enzymes at the brain vascular endothelium: In vivo evidence of a gender-specific cellular response to chronic cigarette smoke exposure Neurosci Lett. 2018-08-23 [PMID: 29879439] (WB, Mouse)

Bioinformatics

• Gene Symbol: ABCB6