Acetylcholinesterase/ACHE Recombinant Protein Antigen

Images

 
There are currently no images for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Acetylcholinesterase/ACHE Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Acetylcholinesterase/ACHE.

Source: E. coli

Amino Acid Sequence: RGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACHE
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55516.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Acetylcholinesterase/ACHE Recombinant Protein Antigen

  • acetylcholinesterase (Yt blood group)
  • Acetylcholinesterase
  • ACHE
  • apoptosis-related acetylcholinesterase
  • ARACHE
  • EC 3.1.1
  • EC 3.1.1.7
  • N-ACHE
  • Yt blood group
  • YT

Background

Cholinergic neurotransmission occurs in motor, autonomic and central nervous synapses and requires very rapid inactivation of its transmitter, acetylcholine (ACh). Acetylcholinesterase (AChE) rapidly hydrolyzes ACh to acetate and choline, thereby inactivating it. AChE is found in the neuromuscular junction anchored to the basal lamina which runs between the nerve terminal and muscle membrane. AChE is also found outside the nervous and neuromuscular system in blood, lymph, germ and liver cells suggesting a role for AChE not related to cholinergic transmission. Another less specific cholinesterase, butyrylcholinesterase (BChE), seems to contribute to the regulation of the ACh concentration in the synaptic cleft.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-13306
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
H00010908-M08
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-46349
Species: Hu
Applications: IHC, IHC-P, WB
256-GF
Species: Hu
Applications: BA

Publications for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP) (0)

There are no publications for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP) (0)

There are no reviews for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Acetylcholinesterase/ACHE Products

Research Areas for Acetylcholinesterase/ACHE Recombinant Protein Antigen (NBP2-55516PEP)

Find related products by research area.

Blogs on Acetylcholinesterase/ACHE.

HIV-associated neurocognitive disorders involve extracellular Nef-induced modification of lipid rafts and redistribution of Alzheimer’s disease-related proteins
Jamshed Arslan, Pharm D, PhD Cholesterol is an essential part of animal cell membranes. Cholesterol-rich lipid rafts maintain the fluidity and protein trafficking of plasma membranes. Cellular ABCA1 protein moves cho...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Acetylcholinesterase/ACHE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACHE