ACSL3 Antibody [CoraFluor™ 1]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: CoraFluor 1

ACSL3 Antibody [CoraFluor™ 1] Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 621-720 of human ACSL3 (NP_004448.2).
  
  Sequence:
  VIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark. Do not freeze.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Notes

CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254

Alternate Names for ACSL3 Antibody [CoraFluor™ 1]

• ACS3EC 6.2.1.3
• acyl-CoA synthetase long-chain family member 3
• FACL3lignoceroyl-CoA synthase
• fatty-acid-Coenzyme A ligase, long-chain 3
• LACS 3
• LACS3
• Long-chain acyl-CoA synthetase 3
• long-chain-fatty-acid--CoA ligase 3
• PRO2194

Background

Long-chain-fatty-acid--CoA ligase 3, or ACSL3, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the biosynthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS3 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL3 mediates hepatic lipogenesis By similarity and has a mainly anabolic role in energy metabolism.

This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACSL3