ALDH1A2 Antibody - BSA Free

Western Blot: ALDH1A2 Antibody [NBP2-84416] - Host: Rabbit. Target Name: Aldh1a2. Sample Type: Mouse Testis lysates. Antibody Dilution: 1.0ug/ml

Western Blot: ALDH1A2 Antibody [NBP2-84416] - Host: Mouse. Target Name: ALDH1A2. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ALDH1A2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ALDH1A2. Peptide sequence: ALMVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALDH1A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ALDH1A2 Antibody - BSA Free

• aldehyde dehydrogenase 1 family, member A2
• Aldehyde dehydrogenase family 1 member A2
• ALDH 1A2
• ALDH1A2
• EC 1.2.1
• EC 1.2.1.36
• RALDH 2
• RALDH
• RALDH(II)
• RALDH2
• RALDH2MGC26444
• RALDH2-T
• retinal dehydrogenase 2
• Retinaldehyde-specific dehydrogenase type 2

Background

ALDH1A2 belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALDH1A2