alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free

Western Blot: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody (M01), clone 1G7.Lane 1: AFP transfected lysate(69 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Immunofluorescence of monoclonal antibody to alpha-Fetoprotein/AFP on HepG2 cell . [antibody concentration 30 ug/ml]

Immunohistochemistry-Paraffin: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Immunoperoxidase of monoclonal antibody to AFP ( Cat # H00000174-M01 ) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Western Blot: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - AFP monoclonal antibody (M01), clone 1G7 Analysis of AFP expression in HepG2.

Immunocytochemistry/Immunofluorescence: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Analysis of monoclonal antibody to AFP on HepG2 cell. Antibody concentration 30 ug/ml.

Immunoprecipitation: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Analysis of AFP transfected lysate using anti-AFP monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AFP MaxPab rabbit polyclonal antibody.

ELISA: alpha-Fetoprotein/AFP Antibody (1G7) [H00000174-M01] - Detection limit for recombinant GST tagged AFP is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Po
• Applications: WB, ELISA, Func, ICC/IF, IHC, IP
• Clone: 1G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
• Specificity: AFP - alpha-fetoprotein
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AFP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Functional
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha-Fetoprotein/AFP Antibody (1G7) - Azide and BSA Free

• AFP
• Alpha-1-fetoprotein
• alpha-fetoglobulin
• alpha-Fetoprotein
• DSCAM2
• FETA
• HP
• HPAFP

Background

This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha-Fetoprotein/AFP Antibody (H00000174-M01)(9)

Publications using H00000174-M01

• Li C, Dong X, Lin Y et al. Establishing a human embryonic stem cell line (SKLRMe005-A) from a blastocyst with congenital heart disease (CHD) Stem cell research 2023-02-13 [PMID: 36805323] (ICC/IF, Human)
• Li C, Cai L, Dong J et al. Establishment of human embryonic stem cell (SKLRMe001-A)carrying Azoospermic factor c (AZFc) deletions Stem cell research 2021-12-18 [PMID: 34952435] (ICC/IF, Human)
• Li Y, Wu S, Yu Y et al. Derivation of porcine extraembryonic endoderm-like cells from blastocysts. Cell Prolif. 2020-03-20 [PMID: 32196806]
• Tsai H, Wu H, Chou B et al. A magneto-microfluidic platform for fluorescence immunosensing using quantum dot nanoparticles. Nanotechnology. 2019-09-26 [PMID: 31557130]
• T Bikkuzin, Y Shi, B Sun, Y Guo, X Jin, Z Han, V Pavlov, H Zhang Human induced pluripotent stem cell line HMUi001-A derived from corneal stromal cells Stem Cell Res, 2019-02-15;37(0):101409. 2019-02-15 [PMID: 31121475]
• Tsai HY, Li SY, Fuh CB. et al. Magnetofluorescent nanocomposites and quantum dots used for optimal application in magnetic fluorescence-linked immunoassay. Anal Bioanal Chem 2018-01-15 [PMID: 29335766]
• Tsai H, Lin W, Chuang M et al. Multifunctional Nanoparticles for Protein Detections in Thin Channels. Biosensors and Bioelectronics 2016-11-12 [PMID: 27886602]
• Funano SI, Sugahara M, Henares TG et al. A single-step enzyme immunoassay capillary sensor composed of functional multilayer coatings for diagnosis marker proteins. Analyst. 2015-01-19 [PMID: 25599100]
• Ramon-Azcon J, Yasukawa T, Mizutani F. Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis. Biosens Bioelectron. 2011-08-04 [PMID: 21846587]

Bioinformatics

• Gene Symbol: AFP
• Entrez:
  • 174(Human)
• OMIM:
  • 104150(Human)
• Uniprot:
  • AAH27881(Human)