AP-2 epsilon/TFAP2E Antibody - BSA Free

Western Blot: AP-2 epsilon/TFAP2E Antibody [NBP2-83935] - WB Suggested Anti-TFAP2E Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Stomach

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

AP-2 epsilon/TFAP2E Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human AP-2 epsilon/TFAP2E. Peptide sequence: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFAP2E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AP-2 epsilon/TFAP2E Antibody - BSA Free

• Activating enhancer-binding protein 2-epsilon
• adaptor-related protein complex 2, epsilon subunit
• AP2 epsilon
• AP-2 epsilon
• AP2E
• AP2-epsilon
• MGC49007
• TFAP2E
• transcription factor AP-2 epsilon (activating enhancer binding protein 2epsilon)
• transcription factor AP-2-epsilon

Background

Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements toregulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activategenes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb andneural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 epsilonmay play a role in the development of the CNS and in cartilage differentiation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFAP2E