![Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ARL13B-Antibody-Immunohistochemistry-Paraffin-NBP2-14312-img0008.jpg "Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: ATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLR |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARL13B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ARL13B Antibody (NBP2-14312)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ARL13B-Antibody-Immunohistochemistry-Paraffin-NBP2-14312-img0005.jpg "Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ARL13B-Antibody-Immunohistochemistry-Paraffin-NBP2-14312-img0006.jpg "Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ARL13B-Antibody-Immunohistochemistry-Paraffin-NBP2-14312-img0007.jpg "Immunohistochemistry-Paraffin: ARL13B Antibody [NBP2-14312] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
