Recombinant Mouse B7-1/CD80 Protein

SDS-Page: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578] - SDS-PAGE analysis of recombinant B7.1-Fc to demonstrate purity of protein.

Bioactivity: Recombinant Mouse B7-1/CD80 Protein [NBP2-26578] - Effect of B7.1-Fc on the growth of tumor cells. B7.1-Fc fusion protein prevents growth of mouse solid tumor, RENCA. The immunotherapy is more more effective in combination with CD25+ depletion and B7.1-Fc fusion protein (PMID: 16322313)

• Reactivity: Mu
• Applications: PAGE, Cell Depl
• Concentration: 2.0 mg/ml

Recombinant Mouse B7-1/CD80 Protein Summary

• Description: A recombinant protein corresponding to CD80.
  
  

  Amino Acid Sequence: MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATL SCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDI TNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPT PSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETEL YAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDDKTHT CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK
  
  Extracellular domain (amino acids 1-241) of human B7.1 sequence is underlined.
  
  Human Fc sequence is in italics.

• Details of Functionality: Can be used as an effective anti-tumor agent in combinantion with Treg depletion. May block binding of membrane bound B7.1 with its receptors, CD28 and CTLA-4, thereby sustaining the activation of tumor specific T cells or preventing their down regulation.
• Source: Baculovirus
• Protein/Peptide Type: Recombinant Protein
• Gene: CD80
• Purity: Protein A purified
• Endotoxin Note: Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.

Applications/Dilutions

• Dilutions:
  • Cell depletion
  • SDS-Page
• Application Notes: Can be used as an effective anti-tumor agent in combinantion with Treg depletion. May block binding of membrane bound B7.1 with its receptors, CD28 and CTLA-4, thereby sustaining the activation of tumor specific T cells or preventing their down regulation
• Theoretical MW: 66 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized.
• Concentration: 2.0 mg/ml
• Purity: Protein A purified

Alternate Names for Recombinant Mouse B7-1/CD80 Protein

• Activation B7-1 antigen
• B7
• B71
• B7-1
• BB1
• CD28LG1
• CD28LGB7-1 antigen)
• CD80 antigen
• CD80 molecule
• CD80
• costimulatory factor CD80
• costimulatory molecule variant IgV-CD80
• CTLA-4 counter-receptor B7.1
• T-lymphocyte activation antigen CD80

Background

B7.1 is a transmembrane protein belonging to a family of costimulatory molecules expressed on the surface of antigen presenting cells (APCs). Binding of B7.1 to the T cell costimulatory receptors, CD28 and CTLA-4, is essential for the activation and regulation of T cell immunity. Mice deficient in B7.1 and B7.2 have profound deficits in both humoral immune responses (antibody production) and cellular immune responses. Soluble B7.1-Fc fusion protein can bind to human and murine T cells and stimulate their proliferation. Recently, B7.1-Fc fusion protein alone or in combination with anti-CD4+ or CD25+ depletion (depletion of Tregs) has been used in animal models to inhibit tumor growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD80