Beta 2 Adaptin Antibody (2D5)

Immunohistochemistry-Paraffin: Beta 2 Adaptin Antibody (2D5) [H00000163-M01] - Analysis of monoclonal antibody to AP2B1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.

ELISA: Beta 2 Adaptin Antibody (2D5) [H00000163-M01] - Detection limit for recombinant GST tagged AP2B1 is 0.1 ng/ml as a capture antibody.

Product Discontinued

Beta 2 Adaptin Antibody (2D5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
• Specificity: Reacts with adaptor-related protein complex 2, beta 1 subunit.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: AP2B1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Beta 2 Adaptin Antibody (2D5)

• Adapter-related protein complex 2 beta subunit
• Adaptor protein complex AP-2 subunit beta
• adaptor-related protein complex 2, beta 1 subunit
• ADTB2adaptin, beta 2 (beta)
• AP105B
• AP2-BETA
• beta-2-adaptin
• beta-adaptin
• CLAPB1AP-2 complex subunit beta
• Clathrin assembly protein complex 2 beta large chain
• clathrin-associated/assembly/adaptor protein, large, beta 1
• DKFZp781K0743
• Plasma membrane adaptor HA2/AP2 adaptin beta subunit

Background

The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP2B1
• Entrez:
  • 163(Human)
• Uniprot:
  • NP_001273(Human)