Recombinant Human CD3 epsilon Protein

Product Discontinued

Recombinant Human CD3 epsilon Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-185 of Human CD3E full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

• Protein/Peptide Type: Recombinant Protein
• Gene: CD3E

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
• Theoretical MW: 46.09 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD3 epsilon Protein

• CD3 epsilon
• CD3e antigen
• CD3e antigen, epsilon polypeptide (TiT3 complex)
• CD3e molecule, epsilon (CD3-TCR complex)
• CD3e
• CD3-epsilon
• FLJ18683
• T3E
• T-cell antigen receptor complex, epsilon subunit of T3
• T-cell surface antigen T3/Leu-4 epsilon chain
• T-cell surface glycoprotein CD3 epsilon chain
• TCRE

Background

CD3E( AAH49847, 23 a.a. - 208 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for CD3 epsilon Recombinant Protein (H00000916-P01). (Showing 1 - 1 of 1 FAQ).

1. What is the molecular weight (without reducing) of H00000916-P01?
   • The protein has a MW of 46.09kDa (which includes a 26kDa GST tag). Unfortunately, we have only tested this protein under reducing conditions, so the weight observed in a non-reducing gel has not been determined.

Bioinformatics

• Gene Symbol: CD3E