CDCA7 Antibody

Immunocytochemistry/Immunofluorescence: CDCA7 Antibody [NBP1-82224] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Product Discontinued

CDCA7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKFRSDISEELANVFYEDSDNESFCGFSESEVQDVLDHCGFLQKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDCA7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23166294)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDCA7 Antibody

• cell division cycle associated 7
• cell division cycle-associated protein 7
• c-Myc target JPO1
• FLJ14722
• FLJ14736
• JPO1cell division cycle associated protein 7
• MGC34109
• Protein JPO1

Background

CDCA7 was identified as a c-Myc responsive gene, and behaves as a direct c-Myc target gene. Overexpression of this gene is found to enhance the transformation of lymphoblastoid cells, and it complements a transformation-defective Myc Box II mutant, suggesting its involvement in c-Myc-mediated cell transformation. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDCA7 Antibody (NBP1-82224)(2)

Publications using NBP1-82224

• Shubbar E, Kovacs A, Hajizadeh S et al. Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome. BMC Cancer 2013-01-02 [PMID: 23282137]
• Gill RM, Gabor TV, Couzens AL et al. The MYC-Associated Protein CDCA7 Is Phosphorylated by AKT To Regulate MYC-Dependent Apoptosis and Transformation. Mol Cell Biol 2013-02-01 [PMID: 23166294]

Bioinformatics

• Gene Symbol: CDCA7