Coilin Antibody

Western Blot: Coilin Antibody [H00008161-B01P] - Analysis of COIL expression in transfected 293T cell line by COIL polyclonal antibody. Lane 1: COIL transfected lysate(63.36 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Coilin Antibody [H00008161-B01P] - Analysis of purified antibody to COIL on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

Coilin Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: COIL (NP_004636.1, 1 a.a. - 576 a.a.) full-length human protein. MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: COIL
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coilin Antibody

• CLN80p80-coilin
• coilin p80
• coilin
• p80

Background

Coilin is encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Coilin Antibody (H00008161-B01P)(1)

Publication using H00008161-B01P

• Schmidt JA, Danielson KG, Duffner ER et al. Regulation of the oncogenic phenotype by the nuclear body protein ZC3H8. BMC Cancer 2018-07-24 [PMID: 30041613]

Bioinformatics

• Gene Symbol: COIL
• Uniprot:
  • NP_004636.1(Human)