Recombinant Human CX3CR1 GST (N-Term) Protein

Recombinant Human CX3CR1 Protein [H00001524-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human CX3CR1 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-355 of Human CX3CR1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CX3CR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Block/Neutralize
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 64.79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CX3CR1 GST (N-Term) Protein

• Beta chemokine receptor-like 1
• CCRL1
• chemokine (C-C) receptor-like 1
• chemokine (C-X3-C motif) receptor 1
• chemokine (C-X3-C) receptor 1
• CMKbRL1
• CMK-BRL1
• CMK-BRL-1
• CMKDR1
• CX3C chemokine receptor 1
• CX3CR1
• Fractalkine receptor
• G protein-coupled receptor 13
• GPR13G-protein coupled receptor 13
• GPRV28
• V28
• V28C-X3-C CKR-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for CX3CR1 Recombinant Protein (H00001524-P01)(1)

Publication using H00001524-P01

• Anderson C, Chu C, Wang Q et al. CX3CR1 as a respiratory syncytial virus receptor in pediatric human lung. Pediatr Res. 2019-11-14 [PMID: 31726465]

Bioinformatics

• Gene Symbol: CX3CR1