CXCR5 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CXCR5 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CXCR5 Antibody
Background
Chemokines play important roles in inflammation and critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors (1). The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. One of the CCR receptors, CCR1, is expressed on neutrophils, monocytes, lymphocytes, and eosinophils and binds the leukocyte chemoattractant and hemopoiesis regulator macrophage-inflammatory protein (MIP-1 ), eotaxin, as well as several other related chemokines (2-4). Mice lacking the chemokine receptor CCR1 have defects in neutrophil trafficking and proliferation (5,6).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, WB
Publications for CXCR5 Antibody (NBP2-48763) (0)
There are no publications for CXCR5 Antibody (NBP2-48763).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CXCR5 Antibody (NBP2-48763) (0)
There are no reviews for CXCR5 Antibody (NBP2-48763).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CXCR5 Antibody (NBP2-48763) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CXCR5 Products
Research Areas for CXCR5 Antibody (NBP2-48763)
Find related products by research area.
|
Blogs on CXCR5