CXCR5 Antibody

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Analysis in human tonsil and cerebral cortex tissues. Corresponding CXCR5 RNA-seq data are presented for the same tissues

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human cerebral cortex shows no positivity as expected.

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: CXCR5 Antibody [NBP2-48763] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells.

Product Discontinued

CXCR5 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CXCR5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CXCR5 Antibody

• BLR1
• BLR1MDR-15
• Burkitt lymphoma receptor 1
• Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif)receptor 5)
• Burkitt lymphoma receptor 1, GTP-binding protein
• CD185 antigen
• CD185
• chemokine (C-X-C motif) receptor 5
• C-X-C chemokine receptor type 5
• CXCR5
• CXC-R5
• MDR15CXCR-5
• MGC117347
• Monocyte-derived receptor 15

Background

Chemokines play important roles in inflammation and critical for the recruitment of effector immune cells to sites of infection. Chemokines activate leukocytes by binding to G protein coupled receptors (1). The ever-growing chemokine receptor subtypes can be divided into 2 major groups, CXCR and CCR, based on the 2 major classes of chemokines. One of the CCR receptors, CCR1, is expressed on neutrophils, monocytes, lymphocytes, and eosinophils and binds the leukocyte chemoattractant and hemopoiesis regulator macrophage-inflammatory protein (MIP-1 ), eotaxin, as well as several other related chemokines (2-4). Mice lacking the chemokine receptor CCR1 have defects in neutrophil trafficking and proliferation (5,6).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CXCR5