CYBB/NOX2 Antibody

Western Blot: CYBB/NOX2 Antibody [NBP2-30099] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml

Western Blot: CYBB/NOX2 Antibody [NBP2-30099]

Western Blot: CYBB/NOX2 Antibody [NBP2-30099] - Analysis of 721_B whole cell lysates, Antibody Dilution: 1 ug/ml.

Western Blot: CYBB/NOX2 Antibody [NBP2-30099] - Sample Type: 721_B Whole Cell lysates Antibody Dilution: 1.0 ug/ml

Western Blot: CYBB/NOX2 Antibody [NBP2-30099] - Sample Type: 721_B Whole Cell lysates Antibody Dilution: 1 ug/ml

Product Discontinued

CYBB/NOX2 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB, Protein (#AA): GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV The peptide sequence for this immunogen was taken from within the described region.
• Specificity: Protein Accession# :NP_000388, Nucleotide Accession#:NM_000397
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYBB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 62 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CYBB/NOX2 Antibody

• CGD
• CGD91-phox
• CYBB
• CYBB/NOX2
• Cytochrome b(558) subunit beta
• cytochrome b-245 heavy chain
• cytochrome b-245, beta polypeptide
• Cytochrome b558 subunit beta
• EC 1.-.-.-
• EC 1.6.3
• gp91-1
• GP91PHOX
• gp91-phox
• Heme-binding membrane glycoprotein gp91phox
• NADPH oxidase 2
• Neutrophil cytochrome b 91 kDa polypeptide
• NOX2
• NOX2chronic granulomatous disease
• p22 phagocyte B-cytochrome
• p91-PHOX
• Superoxide-generating NADPH oxidase heavy chain subunit

Background

Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYBB
• Uniprot:
  • P04839(Human)