DC-STAMP/TM7SF4 Antibody

Product Discontinued

DC-STAMP/TM7SF4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCSTAMP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DC-STAMP/TM7SF4 Antibody

• DCSTAMP
• DC-STAMP
• dendritic cell-specific transmembrane protein
• FIND
• IL-4-induced Protein
• TM7SF4
• transmembrane 7 superfamily member 4

Background

Dendritic cells are unique in their ability to present antigen to naive T cells, and therefore play a central role inthe initiation of immune responses. The protein encoded by this gene is a transmembrane molecule that ispreferentially expressed by dendritic cells. Its expression is down-regulated by ligation of the CD40 molecule.Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of someof these variants has not been determined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCSTAMP
• Uniprot:
  • Q9H295(Human)