DLX5 Antibody (3B11) - Azide and BSA Free

Western Blot: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12), clone 3B11. Lane 1: DLX5 transfected lysatE (31.5 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of monoclonal antibody to DLX5 on HeLa cell. Antibody concentration 10 ug/ml

Western Blot: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of DLX5 expression in PC-12 (Cat # L012V1).

Western Blot: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of DLX5 expression in Raw 264.7 (Cat # L024V1).

Western Blot: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of DLX5 expression in A-431 (Cat # L015V1).

Western Blot: DLX5 Antibody (3B11) [H00001749-M12] - Analysis of DLX5 expression in NIH/3T3 (Cat # L018V1).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 3B11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DLX5 Antibody (3B11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
• Specificity: DLX5 (3B11)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DLX5
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 10 ug/ml
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLX5 Antibody (3B11) - Azide and BSA Free

• distal-less homeo box 5
• distal-less homeobox 5
• DLX5
• homeobox protein DLX-5

Background

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DLX5
• Entrez:
  • 1749(Human)
• OMIM:
  • 600028(Human)
• Uniprot:
  • NP_005212(Human)