EMP3 Antibody (2C4) - Azide and BSA Free

Sandwich ELISA: EMP3 Antibody (2C4) [H00002014-M03] - Detection limit for recombinant GST tagged EMP3 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EMP3 Antibody (2C4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: EMP3 (NP_001416.1, 25 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EMP3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMP3 Antibody (2C4) - Azide and BSA Free

• EMP3
• EMP-3
• epithelial membrane protein 3
• HNMP-1
• Protein YMP
• YMP
• YMPHematopoietic neural membrane protein 1

Background

EMP3 is an integral membrane protein that may be involved in cell proliferation and cell-cell interactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMP3
• Uniprot:
  • NP_001416.1(Human)