Fc gamma RIIB/CD32b Antibody (2E10) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
FCGR2B (AAH31992, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS |
Specificity |
FCGR2B - Fc fragment of IgG, low affinity IIb, receptor (CD32) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
FCGR2B |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IHC-P and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Fc gamma RIIB/CD32b Antibody (2E10) - Azide and BSA Free
Background
Low affinity IgG Fc receptor gamma II (Fc-gamma II), also known as CD32, is a member of the immunoreceptor tyrosine-based activating/inhibitory motif (ITAM/ITIM) family. Fc gamma receptors play a critical role in immunity by linking the IgG antibody mediated response with the regulatory functions of the immune system (1). Three classes of Fc gamma receptor exist; Fc gamma RI (CD64, a high affinity receptor), Fc gamma RII, and RIII (CD32 and CD16 respectively, both low affinity receptors). Fc gamma RIIa is an activating receptor, while RIIb1, RIIb2, and RIIb3 are inhibitory receptors generated by alternative splicing (1-2). Fc gamma RIIa is critical for antigen-presenting-cell activation and Fc gamma RIIb downregulates B-cell functions (3). Fc gamma RIIb has also been known to block the inflammatory immune response in mice (4). Once phosphorylated on tyrosine residues, Fc gamma RIIb associates with SHIP to downregulate phagocytosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Bind
Species: Hu
Applications: Block, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Bind
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Mu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: ELISA
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Publications for Fc gamma RIIB/CD32b Antibody (H00002213-M01) (0)
There are no publications for Fc gamma RIIB/CD32b Antibody (H00002213-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Fc gamma RIIB/CD32b Antibody (H00002213-M01) (0)
There are no reviews for Fc gamma RIIB/CD32b Antibody (H00002213-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Fc gamma RIIB/CD32b Antibody (H00002213-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Fc gamma RIIB/CD32b Products
Research Areas for Fc gamma RIIB/CD32b Antibody (H00002213-M01)
Find related products by research area.
|
Blogs on Fc gamma RIIB/CD32b