FCAR/CD89 Antibody

Western Blot: FCAR/CD89 Antibody [NBP1-88102] - Analysis in control (vector only transfected HEK293T lysate) and FCAR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: FCAR/CD89 Antibody [NBP1-88102] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.

Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staning of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.

Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Simple Western lane view shows a specific band for FCAR in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Electropherogram image(s) of corresponding Simple Western lane view. FCAR/CD89 antibody was used at 1:4 dilution on Liver lysate(s).

Product Discontinued

FCAR/CD89 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCAR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FCAR/CD89 Antibody

• CD89 antigen
• CD89
• CD89IgA Fc receptor
• Fc alpha receptor
• Fc fragment of IgA, receptor for
• FCAR
• immunoglobulin alpha Fc receptor

Background

The CD89 gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. Thereceptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils,monocytes, macrophages, and eosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCAR