FITM1 Antibody

Western Blot: FITM1 Antibody [NBP1-84679] - Analysis in human skeletal muscle tissue.

Immunohistochemistry-Paraffin: FITM1 Antibody [NBP1-84679] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: FITM1 Antibody [NBP1-84679] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts and leydig cells.

Immunohistochemistry-Paraffin: FITM1 Antibody [NBP1-84679] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: FITM1 Antibody [NBP1-84679] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Discontinued

FITM1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FITM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FITM1 Antibody

• fat storage-inducing transmembrane protein 1
• fat-inducing transcript 1
• FIT1Fat-inducing protein 1
• MGC46490

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FITM1 Antibody (NBP1-84679)(1)

Publication using NBP1-84679

• Mormeneo E, Jimenez-Mallebrera C, Palomer X et al. PGC-1? induces mitochondrial and myokine transcriptional programs and lipid droplet and glycogen accumulation in cultured human skeletal muscle cells. PLoS One 2012-01-01 [PMID: 22272266]

Bioinformatics

• Gene Symbol: FITM1