Gas6 Antibody

Immunocytochemistry/Immunofluorescence: Gas6 Antibody [NBP2-54990] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Product Discontinued

Gas6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCINKYGSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAS6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Gas6 Antibody

• AXLLG
• AXLLGAXL stimulatory factor
• AXSFAXL receptor tyrosine kinase ligand
• DKFZp666G247
• FLJ34709
• Gas6
• GAS-6
• growth arrest-specific 6
• growth arrest-specific protein 6

Background

Growth arrest specific proteins, including Gas1 and Gas6, are activated in quiescent cells. Gas1-induced growth arrest is mediated by p53, and Gas1 appears to be able to suppress tumor cell growth. Gas6, a ligand for the tyrosine kinase receptor Axl, was initially identified as a member of the vitamin K-dependent protein family and exhibits a high degree of amino acid sequence homology to protein S, a negative co-regulator in the coagulation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAS6