GBX2 Antibody (1C11) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: GBX2 Antibody (1C11) [H00002637-M04] - Analysis of monoclonal antibody to GBX2 on HeLa cell. Antibody concentration 10 ug/ml

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 1C11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GBX2 Antibody (1C11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GBX2 (NP_001476, 114 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG
• Specificity: GBX2 (1C11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GBX2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GBX2 Antibody (1C11) - Azide and BSA Free

• Gastrulation and brain-specific homeobox protein 2
• gastrulation brain homeo box 2
• gastrulation brain homeobox 2
• GBX2
• homeobox protein GBX-2

Background

GBX2 (Gastrulation brain homeobox 2) is a homeobox protein which is involved in enbryonic cell pluripotency and differentiation. GBX2 is expressed in all three embryonic germ layers of the late gastrula/early neurula. Gbx2 is overexpressed in a panel of human prostatic cancer cell lines (TSU-pr1, PC3, DU145, LNCaP).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBX2
• Entrez:
  • 2637(Human)
• OMIM:
  • 601135(Human)
• Uniprot:
  • NP_001476(Human)