GDF-8/Myostatin Antibody (2D8) - Azide and BSA Free

Western Blot: GDF-8/Myostatin Antibody (2D8) [H00002660-M06] - Analysis of GDF8 expression in transfected 293T cell line by GDF8 monoclonal antibody (M06), clone 2D8. Lane 1: GDF8 transfected lysatE (42.8 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GDF-8/Myostatin Antibody (2D8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GDF8 (NP_005250, 241 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS
• Specificity: GDF8 (2D8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MSTN
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GDF-8/Myostatin Antibody (2D8) - Azide and BSA Free

• GDF8
• GDF-8
• GDF8growth differentiation factor 8
• growth/differentiation factor 8
• MSLHP
• MSTN
• Myostatin

Background

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. This gene is thought to encode a secreted protein which negatively regulates skeletal muscle growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSTN
• Entrez:
  • 2660(Human)
• OMIM:
  • 601788(Human)
• Uniprot:
  • NP_005250(Human)