![Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0834 Experimental design: RNAi was carried out in rrf-3 worms with bacteria carrying empty vector or construct targeting GFL-1. L1 worms were placed on RNAi plates and grown at 20C for three days. Proteins from worms (a mixture of L1s and gravid adults) were prepared by boiling in loading buffer and sonication, and protein concentration determined by the Lowry assay. 50 ug of each protein prep were loaded and antibody was diluted 1:6,000. The coomassie gel shows loading control. RNAi in eri-1 worms showed similar results. Band size deviates slightly from 24.9kD expected.](http://images.novusbio.com/fullsize/gfl-1-Antibody-Western-Blot-29640002-img0003.jpg "Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0834 Experimental design: RNAi was carried out in rrf-3 worms with bacteria carrying empty vector or construct targeting GFL-1. L1 worms were placed on RNAi plates and grown at 20C for three days. Proteins from worms (a mixture of L1s and gravid adults) were prepared by boiling in loading buffer and sonication, and protein concentration determined by the Lowry assay. 50 ug of each protein prep were loaded and antibody was diluted 1:6,000. The coomassie gel shows loading control. RNAi in eri-1 worms showed similar results. Band size deviates slightly from 24.9kD expected.")
| Immunogen | In vivo generated recombinant protein fragment GFL1 |
| Epitope | RLFQPTIELPSGNQIVCMEFYDEIIFQEPTVQMYKALQASDGKRPDKQAFLNDIEQVKTRTRELGEVAQKEIAAEIEDLRESLKDAHKMIVKYNTELAEQ |
| Specificity | This GFL-1 antibody is specific for C. Elegans GFL-1 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | gfl-1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This product is useful for ELISA, Immunofluorescence and Western Blot. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl |
| Preservative | No Preservative |
| Concentration | 1.0 mg/ml |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for gfl-1 Antibody (29640002)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0871 Experimental design: RNAi was carried out in nf-3 worms with bacteria carrying empty vector or a construct targeting GFL-1. L1 worms were placed on RNAi plates and grown at 20C for three days. Proteins from worms (a mixture of L1s and gravid adults) prepared by boiling in loading buffer and sonication, protein concentration determined by the Lowry assay. 50ug of each protein prep were seperated by SDS-PAGE, and WB carried out with 1:6000 dilution of antibody SDQ0871 and 1:10000 dilution of donkey-anti-rabbit-HRP secondary. As controls for equal loading a WB with HIS24 1:5000 was carried out on the stripped blot, and membrane stained with coomassie. Band deviates from the estmated 24.9 kD.](http://images.novusbio.com/fullsize/gfl-1-Antibody-Western-Blot-29640002-img0002.jpg "Western Blot: gfl-1 Antibody [29640002] - This image is specific to animal number SDQ0871 Experimental design: RNAi was carried out in nf-3 worms with bacteria carrying empty vector or a construct targeting GFL-1. L1 worms were placed on RNAi plates and grown at 20C for three days. Proteins from worms (a mixture of L1s and gravid adults) prepared by boiling in loading buffer and sonication, protein concentration determined by the Lowry assay. 50ug of each protein prep were seperated by SDS-PAGE, and WB carried out with 1:6000 dilution of antibody SDQ0871 and 1:10000 dilution of donkey-anti-rabbit-HRP secondary. As controls for equal loading a WB with HIS24 1:5000 was carried out on the stripped blot, and membrane stained with coomassie. Band deviates from the estmated 24.9 kD.")