Glycerol 3 Phosphate Dehydrogenase Antibody

Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate

Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining of human skeletal muscle shows high expresesion.

Western Blot: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: Glycerol 3 Phosphate Dehydrogenase Antibody [NBP1-87411] - Staining in human skeletal muscle and prostate tissues using anti-GPD1 antibody. Corresponding GPD1 RNA-seq data are presented for the same tissues.

Product Discontinued

Glycerol 3 Phosphate Dehydrogenase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 24549054). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24549054).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glycerol 3 Phosphate Dehydrogenase Antibody

• EC 1.1.1
• EC 1.1.1.8
• FLJ26652
• glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
• glycerol-3-phosphate dehydrogenase 1 (soluble)
• glycerol-3-phosphate dehydrogenase, soluble
• GPD-C
• GPDH-C

Background

GPD1( AAH32234, 1 a.a. - 350 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glycerol 3 Phosphate Dehydrogenase Antibody (NBP1-87411)(1)

Publication using NBP1-87411

• Joshi M, Eagan J, Desai NK et al. A compound heterozygous mutation in GPD1 causes hepatomegaly, steatohepatitis, and hypertriglyceridemia. Eur J Hum Genet 2014-10-01 [PMID: 24549054] (WB, Human)

Bioinformatics

• Gene Symbol: GPD1