GULP1/CED-6 Antibody - BSA Free

Western Blot: GULP1/CED-6 Antibody [NBP2-87545] - WB Suggested Anti-GULP1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GULP1/CED-6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GULP1/CED-6. Peptide sequence: AKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYG The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GULP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GULP1/CED-6 Antibody - BSA Free

• CED6
• CED6GULPCED-6
• Cell death protein 6 homolog
• engulfment adapter protein
• FLJ31156
• GULP, engulfment adaptor PTB domain containing 1
• GULP1
• Protein GULP
• PTB domain adapter protein CED-6
• PTB domain adaptor protein CED-6
• PTB domain-containing engulfment adapter protein 1

Background

The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, as well as inflammation and autoimmunity. CED6 and its human homologue gulp, encode an adapter protein, whose function in engulfment. The upstream and downstream components of CED6 mediated signaling are not known. Recently, CED1 has been shown to encode a transmembrane protein on phagocytic cells, with two functional sequence motifs in its cytoplasmic tail that are important for engulfment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for GULP1/CED-6 Antibody (NBP2-87545). (Showing 1 - 1 of 1 FAQ).

1. Is GULP1 localized to mitochondria?
   • I am showing based on localization data from UniProt that it may associate with the cytoplasmic side of the plasma membrane: http://www.uniprot.org/uniprot/Q9UBP9 Additional localization data may be found here at Human protein atlas: http://www.proteinatlas.org/ENSG00000144366

Bioinformatics

• Gene Symbol: GULP1