Recombinant HBsAg Protein

Product Discontinued

Recombinant HBsAg Protein Summary

• Description: Partial recombinant protein corresponding to the amino acids 1-256 of HBsAg
  
  

  Source: Yeast

  Amino Acid Sequence:MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI(Genebankaccession#,CAA05872).

• Source: Yeast
• Protein/Peptide Type: Recombinant Protein
• Gene: S
• Purity: >95%, by SDS-PAGE and HPLC

Applications/Dilutions

• Dilutions:
  • SDS-Page

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: 20 mM phosphate buffer, 154 mM NaCl2.
• Preservative: No Preservative
• Purity: >95%, by SDS-PAGE and HPLC

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant HBsAg Protein

• HBsAg
• HBV major surface antigen
• HBV surface antigen
• Hepatitis B Virus major surface antigen
• Hepatitis B Virus Surface Antigen
• Major surface antigen
• protein S

Background

Hepatitis B Virus (HBV) infection induces a disease state which manifests itself in a variety of ways, characterized by the extent of liver damage, inflammation and viral persistence. HBV infection is also associated with a 100 fold increased risk of hepatocellular carcinoma and currently infects over 250 million people worldwide. HBV has a partially double stranded 3.2 kilobase DNA genome which contains four open reading frames. One of these encodes a 154 amino acid protein called the HBx protein. HBx has been shown to be a transcriptional transactivator of both viral and cellular promoters. Lacking a DNA binding domain and nuclear localization signal, HBx is believed to exert transcriptional activity through protein protein interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: S