HE4/WFDC2 Antibody (3F9)

ELISA: HE4/WFDC2 Antibody (3F9) [H00010406-M01] - Detection limit for recombinant GST tagged WFDC2 is approximately 0.03ng/ml as a capture antibody.

Product Discontinued

HE4/WFDC2 Antibody (3F9) Summary

• Immunogen: WFDC2 (AAH46106.1, 31 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
• Specificity: WFDC2 - WAP four-disulfide core domain 2
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: WFDC2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Functional
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HE4/WFDC2 Antibody (3F9)

• dJ461P17.6
• EDDM4
• Epididymal secretory protein E4
• epididymis-specific, whey-acidic protein type, four-disulfide core
• HE4
• HE4MGC57529
• Major epididymis-specific protein E4
• Putative protease inhibitor WAP5
• WAP domain containing protein HE4-V4
• WAP four-disulfide core domain 2
• WAP four-disulfide core domain protein 2
• WAP5
• WAP5epididymal protein 4
• WFDC2

Background

This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HE4/WFDC2 Antibody (H00010406-M01)(1)

Publication using H00010406-M01

• Yuan J, Duan R, Yang H et al. Detection of serum human epididymis secretory protein 4 in patients with ovarian cancer using a label-free biosensor based on localized surface plasmon resonance. Int J Nanomedicine. 2012-06-12 [PMID: 22745553]

FAQs for HE4/WFDC2 Antibody (H00010406-M01). (Showing 1 - 1 of 1 FAQ).

1. I would like to build a sandwich ELISA for detection of HE4 levels in human blood. I found there are several HE4 antibodies from your company. Could you please provide me some information among these products, which two antibodies will work well with the HE4 antigen in a sandwich ELISA pair?
   • At this time we have not tested any of our HE4 antibodies for use in a Sandwich ELISA. As such, we cannot say with certainty, which will work together as an effective pair. Often times in our experience, choosing a monoclonal antibody for capture, and a polyclonal antibody for detection will yield great results. If you plan on testing any of our HE4 antibodies for use in a Sandwich ELISA then we would encourage you to apply for our Innovators Reward Program. Under the terms of this program, you will be eligible for a full credit in exchange for your data, in the form of an online review, regardless of positive or negative results. Additional Innovator’s Reward information can be found at the following here

Bioinformatics

• Gene Symbol: WFDC2
• Entrez:
  • 10406(Human)
• Uniprot:
  • AAH46106(Human)