HLA C Antibody - Azide and BSA Free

Western Blot: HLA C Antibody [H00003107-B01P] - Analysis of HLA-C expression in transfected 293T cell line by HLA-C polyclonal antibody. Lane 1: HLA-C transfected lysate(40.26 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HLA C Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HLA-C (AAH02463, 1 a.a. - 366 a.a.) full-length human protein. MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAASSNSAQGSDESLIACKA
• Specificity: HLA-C - major histocompatibility complex, class I, C,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HLA-C
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA C Antibody - Azide and BSA Free

• C alpha chain
• D6S204
• FLJ27082
• HLA class I histocompatibility antigen, Cw-1 alpha chain
• HLAC
• HLA-C
• HLA-Cw
• HLA-JY3
• HLC-C
• human leukocyte antigen-C alpha chain
• leucocyte antigen C
• leucocyte antigen Cw
• leukocyte antigen-C alpha chain
• major histocompatibility antigen HLA-C
• major histocompatibility complex, class I, C
• MHC class I antigen Cw*1
• MHC class I antigen Cw*12
• MHC class I antigen Cw*14
• MHC class I antigen Cw*15
• MHC class I antigen Cw*16
• MHC class I antigen Cw*17
• MHC class I antigen Cw*2
• MHC class I antigen Cw*3
• MHC class I antigen Cw*4
• MHC class I antigen Cw*5
• MHC class I antigen Cw*6
• MHC class I antigen Cw*7
• MHC class I antigen Cw*8
• MHC class I antigen heavy chain HLA-C
• PSORS1

Background

HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for HLA C Antibody (H00003107-B01P). (Showing 1 - 1 of 1 FAQ).

1. Can the HLA C Antibody (H00003107-B01P) be used for flow cytometry?
   • We have not tested this antibody for use in Flow Cytometry; however, if you are willing to test this and share your data, you would become eligible for our Innovator's Reward Program, in which you would receive a discount voucher for 100% of the purchase price of this product. Read more about our Innovators Reward Program.

Bioinformatics

• Gene Symbol: HLA-C
• Entrez:
  • 3107(Human)
• Uniprot:
  • AAH02463(Human)