IAH1 Antibody - BSA Free

Western Blot: IAH1 Antibody [NBP2-83071] - Host: Rabbit. Target Name: IAH1. Sample Type: 721_B Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IAH1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human IAH1. Peptide sequence: GYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IAH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IAH1 Antibody - BSA Free

• EC 3.1
• isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae)
• isoamyl acetate-hydrolyzing esterase 1 homolog
• MGC102860
• S

Background

IAH1, also referred to as Isoamyl acetate-hydrolyzing esterase 1 homolog, has 248 amino acids and is approximately 27kDa. IAH1 is a member of the GDSL lipolytic enzyme family, and likely functions as a lipase. Research surrounding IAH1 has shown a possible link to alcoholism. IAH1 has also been shown to interact with alcohol dehydrogenase 5, ATP5O, CABC1, COQ2, and FAAH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IAH1