IL-12 R beta 2 Antibody

Immunohistochemistry-Paraffin: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human cerebral cortex shows strong positivity in neuronal cells.

Immunohistochemistry-Paraffin: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: IL-12 R beta 2 Antibody [NBP1-85983] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Discontinued

IL-12 R beta 2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPSAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL12RB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-12 R beta 2 Antibody

• IL-12 R beta 2
• IL-12 receptor beta 2
• IL-12 receptor subunit beta-2
• IL12R beta 2
• IL-12R subunit beta-2
• IL12RB2
• IL-12Rb2
• IL-12R-beta-2
• interleukin 12 receptor, beta 2
• interleukin-12 receptor beta-2 chain
• interleukin-12 receptor subunit beta-2

Background

IL12RB2 is encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohn's disease and leprosy, which is thought to contribute to the inflammatory response and host defense. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-12 R beta 2 Antibody (NBP1-85983)(1)

Publication using NBP1-85983

• Andreadou M, Ingelfinger F, De Feo D et al. IL-12 sensing in neurons induces neuroprotective CNS tissue adaptation and attenuates neuroinflammation in mice Nature neuroscience 2023-10-01 [PMID: 37749256] (ICC/IF, IHC-P, Human)

Bioinformatics

• Gene Symbol: IL12RB2
• Entrez:
  • 3595(Human)
• Uniprot:
  • Q99665()