![Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/IL-40-Antibody-Immunohistochemistry-Paraffin-NBP1-93716-img0005.jpg "Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTRRLSEEEFGGFRIGNGEVRGRKAAAM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C17orf99 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C17orf99 |
![Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/C17orf99-Antibody-Immunohistochemistry-Paraffin-NBP1-93716-img0001.jpg "Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human kidney shows strong granular ctyoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/IL-40-Antibody-Immunohistochemistry-Paraffin-NBP1-93716-img0003.jpg "Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human kidney shows strong granular ctyoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IL-40-Antibody-Immunohistochemistry-Paraffin-NBP1-93716-img0004.jpg "Immunohistochemistry-Paraffin: IL-40 Antibody [NBP1-93716] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")