Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1305-1404 of Human PRG4 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:ERAIGPSQTHTIRIQYSPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP |
Details of Functionality | This protein is not active and should not be used for experiments requiring activity. |
Protein/Peptide Type | Partial Recombinant Protein |
Gene | PRG4 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
|
Application Notes | This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. |
|
Publications |
|
Storage | Store at -80C. Avoid freeze-thaw cycles. |
Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Publication using H00010216-Q01 | Applications | Species |
---|---|---|
Liu SQ, Tefft BJ, Roberts DT et al. Cardioprotective proteins upregulated in the liver in response to experimental myocardial ischemia. Am J Physiol Heart Circ Physiol 2012-10-12 [PMID: 23064833] |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PRG4 |