MATH2/NEUROD6 Antibody

Immunohistochemistry-Paraffin: MATH2/NEUROD6 Antibody [NBP2-62687] - Analysis in human cerebral cortex and skeletal muscle tissues using Anti-NEUROD6 antibody. Corresponding NEUROD6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MATH2/NEUROD6 Antibody [NBP2-62687] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: MATH2/NEUROD6 Antibody [NBP2-62687] - Staining of human skeletal muscle shows low expression as expected.

Product Discontinued

MATH2/NEUROD6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKS
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEUROD6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for MATH2/NEUROD6 Antibody

• Atoh2
• BHLHA2
• bHLHa2MATH2
• Class A basic helix-loop-helix protein 2
• Math-2
• NeuroD6
• neurogenic differentiation 6
• neurogenic differentiation factor 6
• NEX1M
• Protein atonal homolog 2

Background

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEUROD6