MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free

Western Blot: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - RACGAP1 monoclonal antibody (M01), clone 1G6. Analysis of RACGAP1 expression in Jurkat.

Immunocytochemistry/Immunofluorescence: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - iASPP-dependent localization of midbody markers.a Localization of midbody markers in control, iASPP-depleted, or CEP55-depleted HeLa cells. HeLa cells were transfected with indicated siRNAs. After 48?h, cells were immunostained for midbody markers (green), Beta-tubulin (red), and DNA (blue). b Quantification of proportions of cells from a displaying defects in localization of markers at the midbody Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41419-018-0561-6) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - Analysis of monoclonal antibody to RACGAP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.

Western Blot: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - Western Blot analysis of RACGAP1 expression in K-562 ( Cat # L009V1 ).

Western Blot: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - RACGAP1 monoclonal antibody (M01), clone 1G6. Analysis of RACGAP1 expression in 293.

ELISA: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - Detection limit for recombinant GST tagged RACGAP1 is approximately 0.3ng/ml as a capture antibody.

iASPP-dependent localization of midbody markers.a Localization of midbody markers in control, iASPP-depleted, or CEP55-depleted HeLa cells. HeLa cells were transfected with indicated siRNAs. After 48 h, cells were immunostained for midbody markers (green), beta -tubulin (red), and DNA (blue). b Quantification of proportions of cells from a displaying defects in localization of markers at the midbody

Immunocytochemistry/ Immunofluorescence: MgcRacGAP/RACGAP1 Antibody (1G6) [H00029127-M01] - iASPP-dependent localization of midbody markers.a Localization of midbody markers in control, iASPP-depleted, or CEP55-depleted HeLa cells. HeLa cells were transfected with indicated siRNAs. After 48 h, cells were immunostained for midbody markers (green), beta -tubulin (red), & DNA (blue). b Quantification of proportions of cells from a displaying defects in localization of markers at the midbody Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29743530), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Ch
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free Summary

• Immunogen: RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
• Localization: Cytoplasmic and Nuclear
• Specificity: RACGAP1 - Rac GTPase activating protein 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RACGAP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MgcRacGAP/RACGAP1 Antibody (1G6) - Azide and BSA Free

• GTPase activating protein
• HsCYK-4
• ID-GAP
• KIAA1478
• Male germ cell RacGap
• MgcRacGAP
• MgcRacGAPrac GTPase-activating protein 1
• Rac GTPase activating protein 1
• RACGAP1

Background

Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO (see MIM 165370), RAC (see RAC1; MIM 602048), and CDC42 (MIM 116952). GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MgcRacGAP/RACGAP1 Antibody (H00029127-M01)(8)

Publications using H00029127-M01

• Yang XM, Cao XY, He P et al. Overexpression of Rac GTPase activating Protein 1 Contributes to Proliferation of Cancer Cells by Reducing Hippo Signaling to Promote Cytokinesis. Gastroenterology. 2018-07-12 [PMID: 30009820] (WB, Human)
• Gao K, Zhang Y, Shi Q et al. iASPP-PP1 complex is required for cytokinetic abscission by controlling CEP55 dephosphorylation Cell Death Dis 2018-05-09 [PMID: 29743530] (Human)
• Lawson CD, Fan C, Mitin N et al. Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers. Cancer Res 2016-07-01 [PMID: 27216196]
• Mi S, Lin M, Brouwer-Visser J et al. RNA-seq identification of RACGAP1 as a metastatic driver in uterine carcinosarcoma. Clin Cancer Res 2016-04-27 [PMID: 27121792]
• Lekomtsev S, Su KC, Pye VE et al. Centralspindlin links the mitotic spindle to the plasma membrane during cytokinesis. Nature. 2012-11-09 [PMID: 23235882]
• Wang SM, Ooi LL, Hui KM. Up-regulation of Rac GTPase activating protein 1 is significantly associated with the early recurrence of human hepatocellular carcinoma. Clin Cancer Res. 2011-08-08 [PMID: 21825042]
• Burkard ME, Maciejowski J, Rodriguez-Bravo V et al. Plk1 self-organization and priming phosphorylation of HsCYK-4 at the spindle midzone regulate the onset of division in human cells. PLoS Biol. 2009-05-05 [PMID: 19468302]
• Wolfe BA, Takaki T, Petronczki M, Glotzer M. Polo-Like Kinase 1 Directs Assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF Complex to Initiate Cleavage Furrow Formation. PLoS Biol. 2009-05-05 [PMID: 19468300]

Bioinformatics

• Gene Symbol: RACGAP1
• Entrez:
  • 29127(Human)
• OMIM:
  • 604980(Human)
• Uniprot:
  • AAH32754(Human)