MMR/CD206/Mannose Receptor Antibody

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining in human lung and kidney tissues using anti-MRC1 antibody. Corresponding MRC1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining of human cerebral cortex, liver, lung and placenta using Anti-MMR/CD206/Mannose Receptor antibody NBP2-33439 (A) shows similar protein distribution across tissues to independent antibody NBP1-90020 (B).

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining of human placenta shows strong cytoplasmic positivity in Hofbauer cells.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining of human lung shows high expression.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining of human cerebral cortex shows no cytoplasmic positivity in neurons as expected.

Immunohistochemistry-Paraffin: MMR/CD206/Mannose Receptor Antibody [NBP2-33439] - Staining of human liver shows strong cytoplasmic positivity in Kupffer cells.

Product Discontinued

MMR/CD206/Mannose Receptor Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQSESEKKFLWKYVNRNDAQSA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRC1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MMR/CD206/Mannose Receptor Antibody

• CD206
• CLEC13D
• CLEC13Dmacrophage mannose receptor 1
• C-type lectin domain family 13 member D
• mannose receptor, C type 1
• MMR
• MMRCD206 antigen
• MRC1

Background

The Mannose Receptor (MR), a member of the vertebrate C-type lectin family, is a pattern recognition receptor that is involved in both innate and adaptive immunity. The 180 kDa transmembrane protein consists of 5 domains: an amino-terminal cysteine-rich region, a fibronectin type II repeat, a series of eight tandem lectin-like carbohydrate recognition domains (responsible for the recognition of mannose and fucose), a transmembrane domain, and an intracellular carboxy-terminal tail.The structure is shared by the family of multi lectin mannose receptors: the phospholipase A2-receptor, DEC 205 and the novel C-type lectin receptor (mannose receptor X). The MR recognises a wide range of gram positive and gram negative bacteria, yeasts, parasites and mycobacteria. The MR has also been shown to bind and internalize tissue-type plasminogen activator. MR's are present on monocytes and dendritic cells (DC) and are presumed to play a role in innate and adaptive immunity, the latter via processing by DC. The expression of MR as observed in immunohistology is present on tissue macrophages, dendritic cells, a subpopulation of endothelial cells, Kupffer cells and sperm cells. The expression of MR on monocytes increases during culture and can be enhanced by cytokines such as IFN-gamma. Labeling of MR expressing monocytes/macrophages increases with prolonged incubation time probably due to internalization of the MR-antibody-complex. The antibody 15-2 prevents binding of glycoproteins including t-PA to MR. Detection of the MR with anti-MR monoclonal antibody 15-2 can substitute staining for mannose containing probes as labeled mannosylated BSA, a technique which is more cumbersome and less specific.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRC1
• Uniprot:
  • P22897()