Neurexin 2 alpha/NRXN2a Antibody

Product Discontinued

Neurexin 2 alpha/NRXN2a Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSHTGFGGKFCSEEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRXN2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1-4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Neurexin 2 alpha/NRXN2a Antibody

• Neurexin 2 alpha 2
• NRXN2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRXN2