Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal ...read more
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.
ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.
Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 ...read more
Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of putative iron importers in chronic kidney disease. Representative images of ZIP8 (a–f), ZIP14 (g–l), & divalent ...read more
NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free Summary
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF
Specificity
SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC11A2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Bovine reactivity reported in scientific literature (PMID: 19820055).
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free
DCT1
DCT1NRAMP 2
Divalent cation transporter 1
Divalent metal transporter 1
DMT-1
DMT1FLJ37416
member 2
NRAMP2
NRAMP2natural resistance-associated macrophage protein 2
SLC11A2
solute carrier family 11 (proton-coupled divalent metal ion transporters)
Background
The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01) (0)
There are no reviews for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for NRAMP2/SLC11A2/DMT1 Antibody (H00004891-M01). (Showing 1 - 1 of 1 FAQs).
Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NRAMP2/SLC11A2/DMT1 Antibody (4C6) - Azide and BSA Free and receive a gift card or discount.