NUDT14 Antibody - BSA Free

Western Blot: NUDT14 Antibody [NBP2-85413] - Host: Rabbit. Target Name: NUDT14. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NUDT14 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NUDT14. Peptide sequence: SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NUDT14 Antibody - BSA Free

• EC 3.6.1.45
• Nucleoside diphosphate-linked moiety X motif 14
• nudix (nucleoside diphosphate linked moiety X)-type motif 14
• Nudix motif 14
• UDPG pyrophosphatase
• UDP-sugar diphosphatase
• UGPPase
• UGPPnucleoside diphosphate linked moiety X-type motif 14
• uridine diphosphate glucose pyrophosphatase

Background

UDP-glucose (UDPG) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. NUDT14 is a UDPG pyrophosphatase (EC 3.6.1.45) that hydrolyzes UDPG to produce glucose 1-phosphate and UMP (Yagi et al., 2003 [PubMed 12429023]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT14