Osteocalcin Antibody (2D4) - Azide and BSA Free

Western Blot: Osteocalcin Antibody (2D4) [H00000632-M01] - Analysis of BGLAP expression in transfected 293T cell line by BGLAP monoclonal antibody (M01), clone 2D4.Lane 1: BGLAP transfected lysate(11 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: Osteocalcin Antibody (2D4) [H00000632-M01] - Analysis of monoclonal antibody to BGLAP on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: Osteocalcin Antibody (2D4) [H00000632-M01] - Detection limit for recombinant GST tagged BGLAP is approximately 0.3ng/ml as a capture antibody.

Immunohistochemistry: Osteocalcin Antibody (2D4) [H00000632-M01] - Osteogenic differentiation in 3D. Immunostaining for Osteocalcin (OCN) and nuclear 4′,6-diamidino-2-phenylindole (DAPI) in 3D cultures after 5 weeks. Scale bar = 50 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34948393/) licensed under a CC-BY license.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Osteocalcin Antibody (2D4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: BGLAP (NP_954642, 52 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
• Specificity: BGLAP - bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• Isotype: IgG1 Lambda
• Clonality: Monoclonal
• Host: Mouse
• Gene: BGLAP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Use in IHC reported in scientific literature (PMID:34948393).Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IF..

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Osteocalcin Antibody (2D4) - Azide and BSA Free

• BGLAP
• BGP
• bone gamma-carboxyglutamate (gla) protein (osteocalcin)
• bone gamma-carboxyglutamate (gla) protein
• Bone Gla protein
• Gamma-carboxyglutamic acid-containing protein
• OC
• OCN
• Osteocalcin

Background

Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Osteocalcin Antibody (H00000632-M01)(2)

Publications using H00000632-M01

• Oliveros Anerillas L, Kingham PJ, Lammi MJ et al. Three-Dimensional Osteogenic Differentiation of Bone Marrow Mesenchymal Stem Cells Promotes Matrix Metallopeptidase 13 (MMP13) Expression in Type I Collagen Hydrogels International journal of molecular sciences 2021-12-18 [PMID: 34948393] (IF/IHC, Human)
• de Sousa BM, Correia CR, Ferreira JAF Et al. Capacitive interdigitated system of high osteoinductive/conductive performance for personalized acting-sensing implants NPJ Regenerative medicine 2021-11-23 [PMID: 34815414] (ICC/IF, Mouse)

Bioinformatics

• Gene Symbol: BGLAP
• Entrez:
  • 632(Human)
• OMIM:
  • 112260(Human)
• Uniprot:
  • NP_954642(Human)