In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.
SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.
SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.
Recombinant Mouse OX40 Ligand/TNFSF4 Protein Summary
Description
A recombinant protein corresponding to TNFSF4.
Amino Acid Sequence:EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Mouse Ig-Fc amino acid sequence, followed by linker (SGR) in bold and
Extracellular mouse OX40L amino acid sequence is underlined
Details of Functionality
In vitro proliferation assay, in vivo assays.This protein was measured by its ability to co-stimulate IL-2 secretion in the presence of anti-mCD3, and agonist antibody OX86.
Protein/Peptide Type
Recombinant Protein
Gene
TNFSF4
Purity
Protein A purified
Endotoxin Note
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.
Applications/Dilutions
Dilutions
Functional reported in scientific literature (PMID 24633226)
In vitro assay reported in scientific literature (PMID 24633226)
SDS-Page
Theoretical MW
43.54 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP2-26577 in the following applications:
tumor necrosis factor (ligand) superfamily, member 4
tumor necrosis factor ligand superfamily member 4
TXGP1
Background
OX40 (CD134) and its natural ligand OX40L (CD134L) belong to the tumor necrosis factor superfamily. OX40L is primarily expressed on antigen presenting cells including activated B-cells, dendritic cells, and macrophages. OX40L has been shown to be expressed on activated endothelial cells and CD4+ T-cells during antigen stimulation. OX-40 and OX-40L interactions are crucial for the generation and survival of memory CD4+ T-cells. These interactions may stimulate effector and memory CD4+ and CD8+ T-cells and suppress CD4+/CD25+ Tregs and may have a role in enhanced immune response.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.
Reviews for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577) (0)
There are no reviews for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for OX40 Ligand/TNFSF4 Recombinant Protein (NBP2-26577). (Showing 1 - 1 of 1 FAQs).
Could you let me know the expression cell of this recombinant protein?
The actual cell line(s) that was used is considered a proprietary information, and therefore could be be revealed.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Recombinant Mouse OX40 Ligand/TNFSF4 Protein and receive a gift card or discount.