Pea3 Antibody

Immunocytochemistry/Immunofluorescence: Pea3 Antibody [NBP1-87960] - Staining of human cell line U-251 MG shows localization to nucleoli. Antibody staining is shown in green. Antibody staining is shown in green.

Immunohistochemistry-Frozen: Pea3 Antibody [NBP1-87960] - Pea3 staining on E11.5 mouse Right Ventricle. Fixed 4% PFA overnight. Blocked with 1% BSA. Primary antibody at 1:40. Secondary antibody at 1:1000, conjugated to Alexa Fluor 488. IHC-Fr image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Pea3 Antibody [NBP1-87960] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

Pea3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGV
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETV4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Pea3 Antibody is validated for IHC-Fr from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pea3 Antibody

• Adenovirus E1A enhancer-binding protein
• E1A-FE1A enhancer binding protein
• E1AFETS translocation variant 4
• ets variant 4
• ets variant gene 4 (E1A enhancer binding protein, E1AF)
• ets variant gene 4 (E1A enhancer-binding protein, E1AF)
• EWS protein/E1A enhancer binding protein chimera
• PEA3
• PEAS3
• Polyomavirus enhancer activator 3 homolog
• polyomavirus enhancer activator-3
• Protein PEA3

Background

Pea3, also known as ETS translocation variant 4, is an approximately 54 kDa, 484 amino acid protein, which is involved in transcriptional activation of adenovirus E1A gene, and is regulated by ERBB2, STK11, PLAG1, CTNNB1. Studies about the Pea3 protein are being done on diseases such as ovaria, pancreatic, gastric, breast, and prostate cancers. As well as peripheral primitive neuroectodermal tumors, carcinoma, adenoma, ewings sarcoma, squamous cell carcinoma, and oral cancers. The Pea3 protein has shown interaction with Taf7, EP300, SRF, HOXD4, STK11, and involvement in the ErbB2-ErbB3 Heterodimer pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pea3 Antibody (NBP1-87960)(2)

Publications using NBP1-87960

• Kampf C, Bergman J, Oksvold P et al. A tool to facilitate clinical biomarker studies - a tissue dictionary based on the Human Protein Atlas. BMC Med 2012-09-12 [PMID: 22971420]
• Wollenick K, Hu J, Kristiansen G et al. Synthetic transactivation screening reveals ETV4 as broad coactivator of hypoxia-inducible factor signaling. Nucleic Acids Res 2012-03-01 [PMID: 22075993]

Review for Pea3 Antibody (NBP1-87960) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-Fr Mouse 01/07/2021

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: E11.5 mouse embryo fixed in 4% PFA
• Species: Mouse
• Lot: A33121

Comments

• Comments: Fixed 4% PFA overnight.
  Blocked with 1% BSA
  Primary antibody dilution - 1:40
  Secondary antibody - Invitrogen Alexa Fluor 488
  Secondary antibody - 1:1000

Bioinformatics

• Gene Symbol: ETV4