Recombinant S. aureus Protein A Protein

SDS-Page: Recombinant S. aureus Protein A Protein [NBP3-07005] - Protein A, 48.1 kDa (434aa), confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE.

• Reactivity: Ba
• Applications: PAGE
• Concentration: 1 mg/ml

Recombinant S. aureus Protein A Protein Summary

• Description: An un-tagged recombinant protein corresponding to the amino acids 37-469 of Protein A
  
  Source: E.coli
  
  Amino Acid Sequence: MAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDNKKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNGVHVVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPET
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: SAOUHSC_00069
• Purity: >90%, by SDS-PAGE
• Endotoxin Note: < 1.0 EU per 1 microgram of protein (determined by LAL method)

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Theoretical MW: 48.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20 mM Tris-HCl buffer (pH 8.0), 10% glycerol
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: >90%, by SDS-PAGE

Alternate Names for Recombinant S. aureus Protein A Protein

• Immunoglobulin G binding protein A
• PROA
• Protein A
• Protein-A
• SPA
• Staphylococcal protein A

Background

Protein A is a surface protein of S.aureus which binds IgG molecules by their Fc region. In serum, the bacteria will bind IgG molecules in the wrong orientation on their surface which hinders opsonization and phagocytosis. Mutants of S. aureus lacking protein A are more efficiently phagocytosed in vitro, and mutants in infection models have diminished virulence. Due to its affinity for the Fc region of many mammalian immunoglobulins, protein A is considered a universal reagent in biochemistry and immunology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Protein A Recombinant Protein (NBP3-07005). (Showing 1 - 1 of 1 FAQ).

1. During my master thesis, I am working on a large scale ribosome affinity purification in Trypanosoma brucei. Unfortunately, we have some problems with the present antibody (IgG against protein A, extracted from chicken). Therefore, we are searching a better and more efficient alternative. Ideally it is extracted from guinea pig, rat, mouse or rabbit. Searching suitable antibodies, I found you have some in your range of products. Since we need to work large scale and will need a bigger amount of antibodies the next months, we would like to get the possibility to test the new antibodies first. Therefore I would like to ask for an aliquot for testing. You would really help me finding an good alternative!
   • We unfortunately cannot offer testing samples of our antibodies. I am sorry for any inconvenience. We do have two antibodies to Protein A that meet your host requirements. We fully guarantee our antibodies for all listed species and applications. For any applications and/or species not listed, we offer our Innovators Reward Program. In exchange for a review of your experiment using our product in an untested application or species, we will issue you a credit for the purchase price of the antibody.

Bioinformatics

• Gene Symbol: SAOUHSC_00069