RASEF Antibody - BSA Free

Western Blot: RASEF Antibody [NBP3-09528] - Western blot analysis of RASEF in Fetal Kidney lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

RASEF Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASEF (NP_689786). Peptide sequence AQDKAAMQLSELEEEMDQRIQAAEHKTRKDEKRKAEEALSDLRRQYETEV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RASEF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 81 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for RASEF Antibody - BSA Free

• FLJ31614
• RAB45
• RAB45, member RAS oncogene family
• RAS and EF hand domain containing
• RAS and EF-hand domain containing
• ras and EF-hand domain-containing protein
• Ras-related protein Rab-45

Background

RASEF binds predominantly GDP, and also GTP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RASEF