RhoJ Antibody

Western Blot: RhoJ Antibody [NBP1-57032] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Discontinued

RhoJ Antibody Summary

• Immunogen: Synthetic peptides corresponding to RHOJ (ras homolog gene family, member J) The peptide sequence was selected from the middle region of RHOJ. Peptide sequence LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RHOJ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against RHOJ and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RhoJ Antibody

• ARHJTC10B
• FLJ14445
• ras homolog gene family, member J
• RASL7B
• Ras-like protein family member 7B
• RAS-like, family 7, member B
• RHOI
• rho-related GTP-binding protein RhoJ
• Tc10-like GTP-binding protein
• TC10-like Rho GTPase
• TCLMGC34777

Background

ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RHOJ
• Uniprot:
  • Q9ER71(Mouse)