RNF12 Antibody (1G10) - Azide and BSA Free

Western Blot: RNF12 Antibody (1G10) [H00051132-M01] - RNF12 monoclonal antibody (M01), clone 1G10. Analysis of RNF12 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of monoclonal antibody to RNF12 on HeLa cell. Antibody concentration 30 ug/ml.

Western Blot: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody (M01), clone 1G10.Lane 1: RNF12 transfected lysate (Predicted MW: 68.5 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: RNF12 Antibody (1G10) [H00051132-M01] - Analysis of RNF12 transfected lysate using anti-RNF12 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF12 MaxPab rabbit polyclonal antibody.

ELISA: RNF12 Antibody (1G10) [H00051132-M01] - Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IP
• Clone: 1G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

RNF12 Antibody (1G10) - Azide and BSA Free Summary

• Immunogen: RNF12 (NP_057204, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
• Localization: Cytoplasmic and Nuclear
• Specificity: RNF12 - ring finger protein 12
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RLIM
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunoprecipitation
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27788132).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for RNF12 Antibody (1G10) - Azide and BSA Free

• DKFZp686N06224
• E3 ubiquitin-protein ligase RLIM
• E3 ubiquitin-protein ligase RNF12
• EC 6.3.2
• EC 6.3.2.-
• FLJ25923
• FLJ41093
• LIM domain-interacting RING finger protein
• MGC15161
• NY-REN-43
• Renal carcinoma antigen NY-REN-43
• RING finger LIM domain-binding protein
• RING finger protein 12FLJ42887
• ring finger protein, LIM domain interacting
• ring zinc finger LIM domain binding protein
• ring zinc finger protein NY-REN-43antigen
• R-LIM
• RNF12FLJ45986

Background

The protein encoded by this gene is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF12 Antibody (H00051132-M01)(8)

Publications using H00051132-M01

• Espejo-Serrano C, Aitken C, Tan BF et Al. Chromatin targeting of the RNF12/RLIM E3 ubiquitin ligase controls transcriptional responses Life Sci Alliance 2024-01-10 [PMID: 38199845]
• Bustos F, Segarra-Fas A, Nardocci G et al. Functional Diversification of SRSF Protein Kinase to Control Ubiquitin-Dependent Neurodevelopmental Signaling Dev Cell 2020-10-10 [PMID: 33080171] (WB, Human, Mouse)
• Fukuda A, Tomikawa J, Miura T et al. The role of maternal-specific H3K9me3 modification in establishing imprinted X-chromosome inactivation and embryogenesis in mice. Nat Commun. 2014-10-02 [PMID: 25394724]
• Zhou F, Drabsch Y, Dekker TJ et al. Nuclear receptor NR4A1 promotes breast cancer invasion and metastasis by activating TGF-b signalling. Nat Commun. 2014-03-03 [PMID: 24584437]
• Espejo-Serrano C, Aitken C, Tan B et al. Specific genomic targeting of the RNF12/RLIM E3 ubiquitin ligase selectively programmes developmental transcription bioRxiv 2023-06-14 (WB, Mouse)
  
  Details:
  1:1000 WB dilution
• Fukuda A, Mitani A, Miyashita T et al. Maintenance of Xist Imprinting Depends on Chromatin Condensation State and Rnf12 Dosage in Mice. PLoS Genet 2016-10-01 [PMID: 27788132] (Mouse)
• Federici F, Magaraki A, Wassenaar E et al. Round Spermatid Injection Rescues Female Lethality of a Paternally Inherited Xist Deletion in Mouse. PLoS Genet 2016-10-07 [PMID: 27716834]
• Gao R, Wang L, Cai H et al. E3 Ubiquitin Ligase RLIM Negatively Regulates c-Myc Transcriptional Activity and Restrains Cell Proliferation. PLoS One 2016-09-29 [PMID: 27684546]

Bioinformatics

• Gene Symbol: RLIM
• Entrez:
  • 51132(Human)
• OMIM:
  • 300379(Human)
• Uniprot:
  • NP_057204(Human)