![Western Blot: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody (M01), clone 5H3.Lane 1: RNF212 transfected lysate (Predicted MW: 33.4 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RNF212-Antibody-5H3-Western-Blot-H00285498-M01-img0004.jpg "Western Blot: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of RNF212 expression in transfected 293T cell line by RNF212 monoclonal antibody (M01), clone 5H3.Lane 1: RNF212 transfected lysate (Predicted MW: 33.4 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 5H3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | RNF212 (NP_919420, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKSSVSTKPHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMAPCARRVCHFQRFTMFLHRRLSSLAAPPSVQFWKARGTHQL |
| Specificity | LOC285498 - hypothetical protein LOC285498 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RNF212 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of monoclonal antibody to RNF212 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/RNF212-Antibody-5H3-Immunocytochemistry-Immunofluorescence-H00285498-M01-img0002.jpg "Immunocytochemistry/Immunofluorescence: RNF212 Antibody (5H3) [H00285498-M01] - Analysis of monoclonal antibody to RNF212 on HeLa cell . Antibody concentration 10 ug/ml.")
![Sandwich ELISA: RNF212 Antibody (5H3) [H00285498-M01] - Detection limit for recombinant GST tagged RNF212 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RNF212-Antibody-5H3-Sandwich-ELISA-H00285498-M01-img0003.jpg "Sandwich ELISA: RNF212 Antibody (5H3) [H00285498-M01] - Detection limit for recombinant GST tagged RNF212 is 0.1 ng/ml as a capture antibody.")
